Biological Activity
Endogenous APJ receptor agonist that is secreted by adipocytes. Binds with high affinity to APJ receptors (IC50 = 5.4 nM) and potently inhibits cAMP production in vitro (EC50 = 0.52 nM). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.
Technical Data
M. Wt | 4200.93 |
Formula | C185H304N68O43S |
Sequence | LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF |
Storage | Desiccate at -20°C |
CAS Number | 230299-95-3 |
PubChem ID | 90488763 |
InChI Key | NRXGOOSANFUBIE-ZINMNJNTSA-N |
Smiles | [H]N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
Solubility | Soluble to 1.60 mg/ml in water |
Preparing Stock Solutions
The following data is based on the product molecular weight 4200.93. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
---|---|---|---|
1 mM | 0.24 mL | 1.19 mL | 2.38 mL |
5 mM | 0.05 mL | 0.24 mL | 0.48 mL |
10 mM | 0.02 mL | 0.12 mL | 0.24 mL |
50 mM | 0 mL | 0.02 mL | 0.05 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Zou et al (2000) Apelin peptides block the entry of human immunodeficiency virus (HIV). FEBS Lett. 473 15 PMID: 10802050
Kawamata et al (2001) Molecular properties of apelin: tissue distribution and receptor binding. Biochim.Biophys.Acta 1538 162 PMID: 11336787
Tatemoto et al (1998) Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor. Biochem.Biophys.Res.Comm. 251 471 PMID:
Keywords: Apelin-36 (rat, mouse), supplier, Endogenous, APJ, receptors, agonists, Apelin, adipokines, Apelin, Receptors, Apelin, Receptors, Tocris Bioscience