
Biological Activity
Endogenous peptide secreted from cardiac ventricles in response to volume increase and pressure overload that acts as an agonist at atrial natriuretic peptide (ANP) receptor A (NRP1). Decreases de novo collagen synthesis and increases MMP gene expression in vitro. Exhibits natriuretic, vasodilatory and lusitropic activity and inhibits the sympathetic and renin-angiotensin-aldosterone systems in vivo.
Technical Data
M. Wt | 3464.05 |
Formula | C143H244N50O42S4 |
Sequence |
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Modifications: Disulfide bridge between 10 - 26) |
Storage | Store at -20°C |
CAS Number | 124584-08-3 |
PubChem ID | 53325981 |
InChI Key | HPNRHPKXQZSDFX-OAQDCNSJSA-N |
Smiles | [H]N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@H]1CSSC[C@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CC2=CC=CC=C2)NC1=O)[C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
Solubility | Soluble to 0.10 mg/ml in water |
Preparing Stock Solutions
The following data is based on the product molecular weight 3464.05. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
---|---|---|---|
1 mM | 0.29 mL | 1.44 mL | 2.89 mL |
5 mM | 0.06 mL | 0.29 mL | 0.58 mL |
10 mM | 0.03 mL | 0.14 mL | 0.29 mL |
50 mM | 0.01 mL | 0.03 mL | 0.06 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Tsuruda et al (2002) Brain natriuretic peptide is produced in cardiac fibroblasts and induces matrix metalloproteinases. Circ.Res. 91 1127 PMID: 12480813
Wellard et al (2006) Natriuretic peptides, but not nitric oxide donors, elevate levels of cytosolic guanosine 3',5'-cyclic monophosphate in ependymal cells ex vivo. Neurosci.Lett. 392 187 PMID: 16278044
Heublein et al (2007) Immunoreactivity and guanosine 3',5'-cyclic monophosphate activating actions of various forms of human B-type natriuretic peptide. Hypertension 49 1114 PMID: 17372040
Keywords: Brain natriuretic peptide (1-32) (human), supplier, Endogenous, peptide, agonists, ANP, receptor, A, NRP1, Receptors, Atrial, Natriuretic, Peptide, Natriuretic, Peptide, Receptor, Natriuretic, Peptide, Receptor, Tocris Bioscience