Biological Activity
Endogenous peptide agonist for the CRF receptor (Ki values are 11, 44 and 38 nM for hCRF1, rCRF2a and mCRF2b respectively). Stimulates the synthesis and release of ACTH from the anterior pituitary.
Licensing Information
Sold with the permission of the SALK Institute
Technical Data
| M. Wt | 4758 |
| Formula | C208H344N60O63S2 |
| Sequence |
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII (Modifications: Ile-41 = C-terminal amide) |
| Storage | Desiccate at -20°C |
| CAS Number | 86784-80-7 |
| PubChem ID | 16132357 |
| InChI Key | VXFVFWFSJFSXHN-FAUHKOHMSA-N |
| Smiles | [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
| Solubility | Soluble to 1.10 mg/ml in water |
Preparing Stock Solutions
The following data is based on the product molecular weight 4758. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
| Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
|---|---|---|---|
| 1 mM | 0.21 mL | 1.05 mL | 2.1 mL |
| 5 mM | 0.04 mL | 0.21 mL | 0.42 mL |
| 10 mM | 0.02 mL | 0.11 mL | 0.21 mL |
| 50 mM | 0 mL | 0.02 mL | 0.04 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Perrin and Vale (1999) Corticotropin releasing factor receptors and their ligand family. Ann.N.Y.Acad.Sci. 885 312 PMID: 10816663
Rivier et al (1986) Mediation by corticotropin releasing factor (CRF) of adenohypophysial hormone secretion. Annu.Rev.Physiol. 48 475 PMID: 2871808
Souza et al (1984) Corticotropin-releasing factor receptors in rat forebrain: autoradiographic identification. Science 224 1449 PMID: 6328656
Tache et al (1983) Inhibition of gastric acid secretion in rats by intracerebral injection of corticotropin-releasing factor. Science 222 935 PMID: 6415815
Perrin et al (1999) Comparison of an agonist, urocortin, and an antagonist, astressin, as radioligands for characterization of corticotropin-releasing factor receptors. J.Pharmacol.Exp.Ther. 288 729 PMID: 9918582
Vale et al (1981) Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and β-endorphin. Science 213 1394 PMID: 6267699
Keywords: CRF (human, rat), supplier, Stimulates, ACTH, release, Corticotropin-Releasing, Factor, Non-Selective, CRF, Receptors, agonists, Corticotropin-Releasing, Factor, (human,, rat), Non-selective, CRF, Non-selective, CRF, Tocris Bioscience
