Biological Activity
Endogenous central calcitonin (CT) receptor agonist that stimulates cAMP formation at a potency 350-fold greater than CT (ED50 values are 0.2 and 71 nM respectively). Displays no activity at calcitonin-gene related peptide (CGRP) and adrenomedullin receptors. Inhibits formation of multinuclear osteoclasts with similar efficacy to CT in vitro. Suppresses food intake and increases body temperature in free-feeding rats, and significantly decreases plasma calcium levels in vivo.
Technical Data
| M. Wt | 4098.88 |
| Formula | C175H294N54O49S5 |
| Sequence |
SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG (Modifications: Disulfide bridge between 2 - 7, Gly-38 = C-terminal amide) |
| Storage | Store at -20°C |
| CAS Number | 697327-12-1 |
| PubChem ID | 90488857 |
| InChI Key | GZXYZTLKVIEHJD-BDNMSBJBSA-N |
| Smiles | [H]N[C@@H](CO)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC1=O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)NCC(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
| Solubility | Soluble to 0.50 mg/ml in 10% acetonitrile / water |
Preparing Stock Solutions
The following data is based on the product molecular weight 4098.88. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
| Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
|---|---|---|---|
| 1 mM | 0.24 mL | 1.22 mL | 2.44 mL |
| 5 mM | 0.05 mL | 0.24 mL | 0.49 mL |
| 10 mM | 0.02 mL | 0.12 mL | 0.24 mL |
| 50 mM | 0 mL | 0.02 mL | 0.05 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Katafuchi et al (2003) Calcitonin receptor-stimulating peptide, a new member of the calcitonin gene-related peptide family. Its isolation from porcine brain, structure, tissue distribution, and biological activity. J.Biol.Chem. 278 12046 PMID: 12556539
Sawada et al (2006) Central effects of calcitonin receptor-stimulating peptide-1 on energy homeostasis in rats. Endocrinology 147 2043 PMID: 16410305
Notoya et al (2007) A novel member of the calcitonin gene-related peptide family, calcitonin receptor-stimulating peptide, inhibits the formation and activity of osteoclasts. Eur.J.Pharmacol. 560 234 PMID: 17328890
Keywords: CRSP-1, supplier, Endogenous, central, CT, receptors, calcitonin, agonists, Calcitonin, receptor, stimulating, peptide1, Calcitonin, receptor-stimulating, peptide-1, Calcitonin, and, Related, Receptors, Calcitonin, and, Related, Receptors, Tocris Bioscience
