Biological Activity
Stimulates bone formation by osteoblasts and inhibits bone resorption.
Technical Data
| M. Wt | 3431.9 |
| Formula | C145H240N44O48S2 |
| Sequence |
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP (Modifications: Disulfide bridge between 1 - 7, Pro-32 = C-terminal amide) |
| Storage | Desiccate at -20°C |
| CAS Number | 47931-85-1 |
| PubChem ID | 16133812 |
| InChI Key | BBBFJLBPOGFECG-VJVYQDLKSA-N |
| Smiles | [H]N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC1=O)[C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
| Solubility | Soluble to 1 mg/ml in water |
Preparing Stock Solutions
The following data is based on the product molecular weight 3431.9. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
| Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
|---|---|---|---|
| 1 mM | 0.29 mL | 1.46 mL | 2.91 mL |
| 5 mM | 0.06 mL | 0.29 mL | 0.58 mL |
| 10 mM | 0.03 mL | 0.15 mL | 0.29 mL |
| 50 mM | 0.01 mL | 0.03 mL | 0.06 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Poyner (1995) Pharmacology of receptors for calcitonin gene-related peptide and amylin. TiPS 16 424 PMID: 8578616
van Rossum et al (1997) Neuroanatomical localization, pharmacological characterization and functions of CGRP, related peptides and their receptors. Neurosci.Biobehav.Rev. 21 649 PMID: 9353797
Keywords: Calcitonin (salmon), supplier, bone, formation, resorption, AMY1, AMY2, AMY3, Amylin, CT, Calcitonin, agonist, Calcitonin, and, Related, Receptors, Calcitonin, and, Related, Receptors, Tocris Bioscience
