Biological Activity
Endogenous truncated form of the incretin hormone GIP. More potent at stimulating glucose-dependent insulin secretion from rat pancreatic β-cells than GIP (Cat. No 2084).
Technical Data
| M. Wt | 4633.21 |
| Formula | C210H316N56O61S |
| Sequence | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN |
| Storage | Desiccate at -20°C |
| CAS Number | 725474-97-5 |
| PubChem ID | 71300624 |
| InChI Key | TWSALRJGPBVBQU-PKQQPRCHSA-N |
| Smiles | [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
| Solubility | Soluble to 10 mg/ml in water |
Preparing Stock Solutions
The following data is based on the product molecular weight 4633.21. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
| Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
|---|---|---|---|
| 1 mM | 0.22 mL | 1.08 mL | 2.16 mL |
| 5 mM | 0.04 mL | 0.22 mL | 0.43 mL |
| 10 mM | 0.02 mL | 0.11 mL | 0.22 mL |
| 50 mM | 0 mL | 0.02 mL | 0.04 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Xie et al (2004) GIP1-39, a novel insulinotropic peptide form and aspects on its mechanism of action. Regul.Peptides 121 107 PMID:
Keywords: GIP (1-39), supplier, potent, insulinotropic, peptide, Gastric, inhibitory, Peptide, Receptors, Glucose-Dependent, Insulinotropic, GIP, Glucagon, Gastric, Inhibitory, Polypeptide, (1-39), GIP, Receptors, GIP, Receptors, Tocris Bioscience

