Biological Activity
Endogenous GLP-1 receptor ligand; bioactive and truncated form of GLP-1; insulinotropic hormone.
Technical Data
| M. Wt | 3355.71 |
| Formula | C151H228N40O47 |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Storage | Store at -20°C |
| CAS Number | 106612-94-6 |
| PubChem ID | 16133830 |
| InChI Key | GCYXWQUSHADNBF-AAEALURTSA-N |
| Smiles | [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
| Solubility | Soluble to 1 mg/ml in water |
Preparing Stock Solutions
The following data is based on the product molecular weight 3355.71. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
| Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
|---|---|---|---|
| 1 mM | 0.3 mL | 1.49 mL | 2.98 mL |
| 5 mM | 0.06 mL | 0.3 mL | 0.6 mL |
| 10 mM | 0.03 mL | 0.15 mL | 0.3 mL |
| 50 mM | 0.01 mL | 0.03 mL | 0.06 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Marchetti et al (2012) A local glucagon-like peptide 1 (GLP-1) system in human pancreatic islets. Diabetologia 55 3262 PMID: 22965295
Ban et al (2010) Glucagon-like peptide (GLP)-1(9-36)amide-mediated cytoprotection is blocked by exendin(9-39) yet does not require the known GLP-1 receptor. Endocrinology 151 1520 PMID: 20172966
Keywords: GLP-1 (7-37), supplier, Endogenous, GLP-1, receptor, ligands, bioactive, truncated, form, Glucagon, like, peptide, receptor, insulinotropic, proglucagon, agonists, Glucagon-Like, Peptide, 1, Receptors, Glucagon-Like, Peptide, 1, Receptors, Tocris Bioscience

