Biological Activity
Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on gastrointestinal function including regulation of intestinal glucose transport, food intake, and gastric acid secretion.
Technical Data
| M. Wt | 3796.17 |
| Formula | C166H256N44O56S |
| Sequence | HADGSFSDEMNTILDNLATRDFINWLIQTKITD |
| Storage | Desiccate at -20°C |
| CAS Number | 195262-56-7 |
| PubChem ID | 90488760 |
| InChI Key | KBNPAOMRSZGNFV-XBBCIFKHSA-N |
| Smiles | [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
| Solubility | Soluble to 1 mg/ml in water |
Preparing Stock Solutions
The following data is based on the product molecular weight 3796.17. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
| Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
|---|---|---|---|
| 1 mM | 0.26 mL | 1.32 mL | 2.63 mL |
| 5 mM | 0.05 mL | 0.26 mL | 0.53 mL |
| 10 mM | 0.03 mL | 0.13 mL | 0.26 mL |
| 50 mM | 0.01 mL | 0.03 mL | 0.05 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Rocha et al (2004) Glucagon-like peptide-2: divergent signalling pathways. J.Surg.Res. 121 5 PMID: 15313368
Brubaker and Drucker (2004) Glucagon-like peptides regulate cell proliferation and apoptosis in the pancreas, gut, and central nervous system. Endocrinol. 145 2653 PMID:
Bulut et al (2004) Glucagon-like peptide 2 improves intestinal wound healing through induction of epithelial cell migration in vitro-evidence for a TGF-β-mediated effect. Reg.Peptides 121 137 PMID:
Keywords: GLP-2 (rat), supplier, Endogenous, hormone, displays, intestinotrophic, activity, GLP2, Receptors, Glucagon-Like, Peptide, 2, peptide2, (rat), Glucagon-like, peptide, 2, (rat), Glucagon-Like, Peptide, 2, Receptors, Glucagon-Like, Peptide, 2, Receptors, Tocris Bioscience

