Biological Activity
Endogenous peptide with multiple endocrine, metabolic and behavioral effects. Has been shown to have an action on intestinal smooth muscle, insulin and somatostatin release, and synaptic neurotransmission.
Technical Data
| M. Wt | 3157.41 |
| Formula | C139H210N42O43 |
| Sequence | GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS |
| Storage | Desiccate at -20°C |
| CAS Number | 119418-04-1 |
| PubChem ID | 16133823 |
| InChI Key | CBSXZYWGVAQSHI-RUKUCZSXSA-N |
| Smiles | [H]NCC(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
| Solubility | Soluble to 0.50 mg/ml in water |
Preparing Stock Solutions
The following data is based on the product molecular weight 3157.41. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
| Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
|---|---|---|---|
| 1 mM | 0.32 mL | 1.58 mL | 3.17 mL |
| 5 mM | 0.06 mL | 0.32 mL | 0.63 mL |
| 10 mM | 0.03 mL | 0.16 mL | 0.32 mL |
| 50 mM | 0.01 mL | 0.03 mL | 0.06 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Niiro et al (1998) Mechanisms of galanin-induced contraction in the rat myometrium. Br.J.Pharmacol. 124 1623 PMID: 9756377
Schmidt et al (1991) Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide. Proc.Natl.Acad.Sci.U.S.A. 88 11435 PMID: 1722333
Wang et al (1998) Hypothalamic galanin: control by signals of fat metabolism. Brain Res. 804 7 PMID: 9729239
Keywords: Galanin (1-30) (human), supplier, Endogenous, galanin, agonists, GAL, GalR, Receptors, Galanin, Galanin, Receptors, Galanin, Receptors, Tocris Bioscience
