Biological Activity
Pancreatic hormone synthesized by post-translational processing of proglucagon. Unlike truncated forms of GLP-1, it has no effect on food intake in rats and does not enhance pancreatic insulin secretion. However it induces insulin expression in intestinal epithelial cells, which can restore glucose homeostasis when implanted into diabetic mice.
Technical Data
| M. Wt | 4169.52 |
| Formula | C186H275N51O59 |
| Sequence | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Storage | Desiccate at -20°C |
| CAS Number | 87805-34-3 |
| PubChem ID | 16131070 |
| InChI Key | UKVFVQPAANCXIL-FJVFSOETSA-N |
| Smiles | [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
| Solubility | Soluble to 5 mg/ml in water |
Preparing Stock Solutions
The following data is based on the product molecular weight 4169.52. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
| Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
|---|---|---|---|
| 1 mM | 0.24 mL | 1.2 mL | 2.4 mL |
| 5 mM | 0.05 mL | 0.24 mL | 0.48 mL |
| 10 mM | 0.02 mL | 0.12 mL | 0.24 mL |
| 50 mM | 0 mL | 0.02 mL | 0.05 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Bell et al (1983) Exon duplication and divergence in the human preproglucagon gene. Nature 304 368 PMID: 6877358
Navarro et al (1996) Colocalization of glucagon-like peptide-1 (GLP-1) receptors, glucose transporter GLUT-2, and glucokinase mRNAs in rat hypothalamic cells: evidence for a role of GLP-1 receptor agonists as an inhibitory signal for food and water intake. J.Neurochem. 67 1982 PMID: 8863504
Suzuki et al (2003) Glucagon-like peptide 1 (1-37) converts intestinal epithelial cells into insulin-producing cells. Proc.Natl.Acad.Sci.USA 100 5034 PMID:
Keywords: Glucagon-like peptide 1 (1-37) (human, rat), supplier, Endogenous, pancreatic, peptide, GLP1, Receptors, Glucagon-Like, Peptide, 1, Glucagon-like, peptide1, (1-37), (human, rat), GLP1(1-37), amide, diabetes, GLP-1, (1-37), amide, Glucagon-Like, Peptide, 1, Receptors, Glucagon-Like, Peptide, 1, Receptors, Tocris Bioscience

