Biological Activity
Potent and selective N-type Ca2+ channel blocker (IC50 ~ 60 nM); selectively and reversibly blocks N-type Ca2+ channels. Does not block T-type Ca2+ channels, K+ channels or Na+ channels. Exhibits analgesic effects in vivo.
Technical Data
| M. Wt | 4437.13 |
| Formula | C196H292N50O56S6 |
| Sequence |
CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK (Modifications: Disulfide bridge: 1-16,8-21,15-36) |
| Storage | Store at -20°C |
| CAS Number | 1600543-88-1 |
| PubChem ID | 90489025 |
| InChI Key | JEUFUDFTZMBKGH-UHFFFAOYSA-N |
| Smiles | [H]N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC4=CNC=N4)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H]4CCCN4C(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@@H]4CCCN4C(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](NC1=O)[C@@H](C)CC)C(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N3)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CO)NC2=O)C(C)C)[C@@H](C)O)[C@@H](C)CC)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
| Solubility | Soluble to 1 mg/ml in water |
Preparing Stock Solutions
The following data is based on the product molecular weight 4437.13. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
| Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
|---|---|---|---|
| 1 mM | 0.23 mL | 1.13 mL | 2.25 mL |
| 5 mM | 0.05 mL | 0.23 mL | 0.45 mL |
| 10 mM | 0.02 mL | 0.11 mL | 0.23 mL |
| 50 mM | 0 mL | 0.02 mL | 0.05 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Deng et al (2014) Huwentoxin-XVI, an analgesic, highly reversible mammalian N-type calcium channel antagonist from Chinese tarantula Ornithoctonus huwena. Neuropharmacology 79 657 PMID: 24467846
Jiang et al (2010) Venomics of the spider Ornithoctonus huwena based on transcriptomic versus proteomic analysis. Comp.Biochem.Physiol.Part D Genomics Proteomics 5 81 PMID: 20403776
Keywords: Huwentoxin XVI, supplier, Huwentoxin, 16, Potent, selective, N, type, Ca2+, channel, blockers, reversible, analgesics, venoms, Voltage-gated, Calcium, Channels, Voltage-gated, Calcium, Channels, Tocris Bioscience
