
Biological Activity
Selective blocker of the big conductance Ca2+-activated K+ channel.
Technical Data
M. Wt | 4230 |
Formula | C179H274N50O55S7 |
Sequence |
XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ (Modifications: X-1 = pGlu, Disulfide bridge between 7 - 28,13 - 33,17 - 35) |
Storage | Desiccate at -20°C |
CAS Number | 129203-60-7 |
PubChem ID | 16132435 |
InChI Key | VDNVVLOBNHIMQA-UHFFFAOYSA-N |
Smiles | [H]N1[C@@H](CCC1=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CO)NC1=O)C(C)C)C(=O)N[C@@H](CC1=CNC4=C1C=CC=C4)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N3)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCSC)NC2=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(O)=O)C(C)C |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
Solubility | Soluble to 0.70 mg/ml in water |
Preparing Stock Solutions
The following data is based on the product molecular weight 4230. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
---|---|---|---|
1 mM | 0.24 mL | 1.18 mL | 2.36 mL |
5 mM | 0.05 mL | 0.24 mL | 0.47 mL |
10 mM | 0.02 mL | 0.12 mL | 0.24 mL |
50 mM | 0 mL | 0.02 mL | 0.05 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Galvez et al (1990) Purification and characterization of a unique, potent, peptidyl probe for the high conductance calcium-activated potassium channel from venom of the scorpion Buthus tamulus. J.Biol.Chem. 265 11083 PMID: 1694175
Suarez-Kurtz et al (1991) Effects of charybdotoxin and iberiotoxin on the spontaneous motility and tonus of different guinea-pig smooth muscle tissues. J.Pharmacol.Exp.Ther. 259 439 PMID: 1717682
Keywords: Iberiotoxin, supplier, K+, channel, blockers, high, conductance, Ca2+-dependent, Potassium, KCa, Channels, ca2+-activated, ca2+-dependent, venoms, Ca2+-Activated, Potassium, Channels, Ca2+-Activated, Potassium, Channels, Tocris Bioscience