Biological Activity
Selective blocker of NaV1.5 channels (IC50 = 348 nM); displays no effect on other isoforms, including NaV1.2, NaV1.4, NaV1.6 and NaV1.7. Thought to inhibit sodium channel activation by binding to the NaV1.5 S3-S4 linker of domain II. Selectively inhibits the activation of cardiac sodium channels, but has no effect on sodium channels in dorsal root ganglion neurons.
Technical Data
Formula | C174H241N47O46S6 |
Sequence |
DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP (Modifications: Disulfide bridge: 4-19,11-24,18-31) |
Storage | Store at -20°C |
CAS Number | 925463-91-8 |
PubChem ID | 90488988 |
InChI Key | OKELXNUZHJLTAQ-UHFFFAOYSA-N |
Smiles | [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)CNC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)CNC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)[C@H](C)NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)CNC(=O)[C@H](CCCCN)NC2=O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
Solubility | Soluble to 1 mg/ml in water |
Product Datasheets
References
References are publications that support the products' biological activity.
Xiao et al (2004) Jingzhaotoxin-III, a novel spider toxin inhibiting activation of sodium channel in rat cardiac myocytes. J.Biol.Chem. 279 26220 PMID: 15084603
Rong et al (2011) Molecular basis of the tarantula toxin jingzhaotoxin-III (β-TRTX-Cj1α) interacting with voltage sensors in sodium channel subtype Nav1.5. FASEB J. 25 3177 PMID: 21665957
Keywords: Jingzhaotoxin III, supplier, cardiotoxins, NaV1.5, selective, ion, channels, sodium, blockers, blocks, inhibitors, inhibits, venoms, Voltage-gated, Sodium, Channels, Voltage-gated, Sodium, Channels, Tocris Bioscience