Biological Activity
Human putative counterpart of nocistatin (bovine). Blocks nociceptin-induced allodynia and hyperalgesia.
Technical Data
| M. Wt | 3561.93 |
| Formula | C149H238N42O53S3 |
| Sequence | MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ |
| Storage | Desiccate at -20°C |
| CAS Number | 212609-11-5 |
| PubChem ID | 90479770 |
| InChI Key | OEZVAQPRAUPWHZ-FBGOCWIPSA-N |
| Smiles | [H]N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Preparing Stock Solutions
The following data is based on the product molecular weight 3561.93. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
| Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
|---|---|---|---|
| 1 mM | 0.28 mL | 1.4 mL | 2.81 mL |
| 5 mM | 0.06 mL | 0.28 mL | 0.56 mL |
| 10 mM | 0.03 mL | 0.14 mL | 0.28 mL |
| 50 mM | 0.01 mL | 0.03 mL | 0.06 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
on-line. Please contact Customer Service
References
References are publications that support the products' biological activity.
Minami et al (1998) Anti-nociceptive responses produced by human putative counterpart of nocistatin. Br.J.Pharmacol. 124 1016 PMID: 9720768
Okuda-Ashitaka and Ito (2000) Nocistatin: a novel neuropeptide encoded by the gene for the nociceptin/orphanin FQ precursor. Peptides 21 1101 PMID: 10998544
Keywords: Nocistatin (human), supplier, Human, putative, counterpart, nocistatin, Nociceptin, Receptors, ORL1, OP4, NOP, Opioid, antagonists, NOP, Receptors, NOP, Receptors, Tocris Bioscience

