Biological Activity
Endogenous glucagon-like peptide that modulates feeding and metabolism; secreted by intestinal L-cells. Increases cAMP production and inhibits gastric acid secretion in rat stomach.
Technical Data
| M. Wt | 4421.86 |
| Formula | C192H295N59O60S |
| Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
| Storage | Desiccate at -20°C |
| CAS Number | 62340-29-8 |
| PubChem ID | 16144019 |
| InChI Key | PXZWGQLGAKCNKD-DPNMSELWSA-N |
| Smiles | [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
| Solubility | Soluble to 1 mg/ml in water |
Preparing Stock Solutions
The following data is based on the product molecular weight 4421.86. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
| Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
|---|---|---|---|
| 1 mM | 0.23 mL | 1.13 mL | 2.26 mL |
| 5 mM | 0.05 mL | 0.23 mL | 0.45 mL |
| 10 mM | 0.02 mL | 0.11 mL | 0.23 mL |
| 50 mM | 0 mL | 0.02 mL | 0.05 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Bataille et al (1981) Bioactive enteroglucagon (oxyntomodulin): present knowledge on its chemical structure and its biological activities. Peptides 2 41 PMID: 6283496
Stumpel et al (1997) A new role for enteric glucagon-37: acute stimulation of glucose absorption in rat small intestine. FEBS Lett. 410 515 PMID: 9237694
Jarrousse et al (1985) Oxyntomodulin (glucagon-37) and its C-terminal octapeptide inhibit gastric acid secretion. FEBS Lett. 188 81 PMID: 4018272
Keywords: Oxyntomodulin (porcine, bovine), supplier, Endogenous, gut, peptide, modulates, feeding, metabolism, GLP1, Receptors, Glucagon-Like, Peptide, 1, Glucagon, Glucagon, (1-37), Enteroglucagon, Glucagon-Like, Peptide, 1, Receptors, Glucagon, Receptor, Glucagon-Like, Peptide, 1, Receptors, Tocris Bioscience

