
Biological Activity
Endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP) but with a greater potency for stimulation of adenylyl cyclase.
Technical Data
M. Wt | 4535 |
Formula | C203H331N63O53S |
Sequence |
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK (Modifications: Lys-38 = C-terminal amide) |
Storage | Desiccate at -20°C |
CAS Number | 137061-48-4 |
PubChem ID | 44566111 |
InChI Key | UFTCZKMBJOPXDM-XXFCQBPRSA-N |
Smiles | [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
Solubility | Soluble to 0.90 mg/ml in water |
Preparing Stock Solutions
The following data is based on the product molecular weight 4535. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
---|---|---|---|
1 mM | 0.22 mL | 1.1 mL | 2.21 mL |
5 mM | 0.04 mL | 0.22 mL | 0.44 mL |
10 mM | 0.02 mL | 0.11 mL | 0.22 mL |
50 mM | 0 mL | 0.02 mL | 0.04 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Lazarovici et al (1998) The 38-amino-acid form of pituitary adenylate cyclase-activating polypeptide induces neurite outgrowth in PC12 cells that is dependent on protein kinase C and extracellular signal-regulated kinase but not on protein kinase A, nerve growth factor receptor Mol.Pharmacol. 54 547 PMID: 9730914
Michel et al (1998) XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 50 143 PMID: 9549761
Rawlings et al (1994) Pituitary adenylate cyclase-activating polypeptide increase [Ca2+]i in rat gonadotrophs through an inositol trisphosphate-dependent mechanism. J.Biol.Chem. 269 5680 PMID: 7907085
Keywords: PACAP 1-38, supplier, Potently, stimulates, adenylyl, cyclases, stimulator, adenylate, Inositol, cAMP, Signaling, Signalling, Pituitary, Adenylate, Activating, Peptide, Receptors, PAC1, PACAP138, Pituitary, Adenylate, Cyclase-Activating, Polypeptide, 1-38, PACAP, Receptors, Adenylyl, Cyclase, PACAP, Receptors, Tocris Bioscience