
Biological Activity
Cell-permeable peptide cleaved from protease-activated receptor 1 (PAR1) upon receptor activation. Attenuates endothelial cell migration and proliferation (IC50 ~ 3 μM), and induces cell cycle arrest. Promotes activation of caspase-3 and exhibits pro-apoptotic activity in vitro. Inhibits angiogenesis and exhibits cardioprotective activity in vivo.
Technical Data
M. Wt | 4467.29 |
Formula | C191H330N64O53S3 |
Sequence | MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR |
Storage | Store at -20°C |
CAS Number | 1065755-99-8 |
PubChem ID | 90488856 |
InChI Key | SVAINNLHALEEHP-HQNSSEMESA-N |
Smiles | [H]N[C@@H](CCSC)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CS)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
Solubility | Soluble to 1 mg/ml in water |
Preparing Stock Solutions
The following data is based on the product molecular weight 4467.29. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
---|---|---|---|
1 mM | 0.22 mL | 1.12 mL | 2.24 mL |
5 mM | 0.04 mL | 0.22 mL | 0.45 mL |
10 mM | 0.02 mL | 0.11 mL | 0.22 mL |
50 mM | 0 mL | 0.02 mL | 0.04 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Zania et al (2009) Parstatin, the cleaved peptide on proteinase-activated receptor 1 activation, is a potent inhibitor of activation. J.Pharmacol.Exp.Ther. 328 378 PMID: 18988770
Strande et al (2009) Parstatin: a cryptic peptide involved in cardioprotection after ischaemic and reperfusion injury. Cardiovasc.Res. 83 325 PMID: 19380418
Keywords: Parstatin (human), supplier, Peptide, cleaved, PAR1, receptors, activation, Protease-Activated, proteinase-activated, Protease-Activated, Receptors, Protease-Activated, Receptors, Tocris Bioscience