Biological Activity
Y2 selective agonist. IC50 values are 0.11 and 1050 nM for inhibition of 125I-PYY binding to Y2 and Y1 receptors respectively. Inhibits food intake and reduces weight gain in vivo. Brain penetrant.
Technical Data
| M. Wt | 3980.4 |
| Formula | C176H272N52O54 |
| Sequence |
AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY (Modifications: Tyr-34 = C-terminal amide) |
| Storage | Desiccate at -20°C |
| CAS Number | 126339-09-1 |
| PubChem ID | 90479816 |
| InChI Key | AIYOBVCUSVSXOL-NYGOYQSZSA-N |
| Smiles | [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
| Solubility | Soluble to 1 mg/ml in water |
Preparing Stock Solutions
The following data is based on the product molecular weight 3980.4. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
| Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
|---|---|---|---|
| 1 mM | 0.25 mL | 1.26 mL | 2.51 mL |
| 5 mM | 0.05 mL | 0.25 mL | 0.5 mL |
| 10 mM | 0.03 mL | 0.13 mL | 0.25 mL |
| 50 mM | 0.01 mL | 0.03 mL | 0.05 mL |
Molarity Calculator
Reconstitution Calculator
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Batterham et al (2002) Gut hormone PYY3-36 physiologically inhibits food intake. Nature 418 650 PMID: 12167864
Keire et al (2000) Primary structures of PYY, [Pro34]PYY and PYY-(3-36) confer different conformations and receptor selectivity. Am.J.Physiol.Gastrointest.Liver Physiol. 279 G126 PMID: 10898754
Nonaka et al (2003) Characterization of blood-brain barrier permeability to PYY3-36 in the mouse. J.Pharmacol.Exp.Ther. 306 948 PMID: 12750431
Keywords: Peptide YY (3-36), supplier, Selective, Y2, receptor, agonists, Neuropeptide, Y, Receptors, NPY, PeptideYY, (3-36), PYY336, neuropeptides, PYY, 3-36, NPY, Receptors, NPY, Receptors, Tocris Bioscience

